DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30A and Naa30

DIOPT Version :9

Sequence 1:NP_726727.1 Gene:Naa30A / 31079 FlyBaseID:FBgn0024362 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001102569.1 Gene:Naa30 / 498489 RGDID:1559923 Length:362 Species:Rattus norvegicus


Alignment Length:259 Identity:129/259 - (49%)
Similarity:157/259 - (60%) Gaps:23/259 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 SDSNSLKPEEKP-ITATSKTTANIHP------------TTTTDPKPKVSEDVAVEQGVHVATG-- 189
            |.:.:..|:..| :|||.  .|..||            .|....:|:.:...|.......||.  
  Rat   106 SAAEAAAPDGAPKVTATK--GAEGHPGERPPHSVPNNARTALPGRPEAAAAAAAGAASDPATSRN 168

  Fly   190 ---SGHSREQERKQPPSDYAEGATPTITAQLQLPEPAISADE--IVYKEYEAEHQMHDIMRLIQA 249
               .|:.:|:|..:.....:...|...:....|...|...::  |.|..||:|.||.||||||..
  Rat   169 GLVEGNEQEEEEDEQVRLLSSSLTTGCSLSSSLGREAEPGEDRTIRYVRYESELQMPDIMRLITK 233

  Fly   250 ELSEPYSIYTYRYFIYNWPKLCFLASHDNQYVGAIVCKLDMHMNV-RRGYIAMLAVRKEYRKLKI 313
            :||||||||||||||:|||:|||||....:.|||||||||||..: ||||||||||..:||:..|
  Rat   234 DLSEPYSIYTYRYFIHNWPQLCFLAMVGEECVGAIVCKLDMHKKMFRRGYIAMLAVDSKYRRNGI 298

  Fly   314 GTTLVTKAIEAMLADNADEVVLETEMRNQPALRLYENLGFVRDKRLFRYYLNGVDALRLKLWFR 377
            ||.||.|||.||:..:.||||||||:.|:.||:|||||||||||||||||||||||||||||.|
  Rat   299 GTNLVKKAIYAMVEGDCDEVVLETEITNKSALKLYENLGFVRDKRLFRYYLNGVDALRLKLWLR 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30ANP_726727.1 rimI 242..370 CDD:273701 94/128 (73%)
Acetyltransf_1 276..354 CDD:278980 50/78 (64%)
Naa30NP_001102569.1 RimI 209..362 CDD:223532 108/152 (71%)
Acetyltransf_1 <281..339 CDD:278980 38/57 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351568
Domainoid 1 1.000 145 1.000 Domainoid score I4469
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1323575at2759
OrthoFinder 1 1.000 - - FOG0002360
OrthoInspector 1 1.000 - - oto98470
orthoMCL 1 0.900 - - OOG6_101962
Panther 1 1.100 - - LDO PTHR45896
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2923
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.850

Return to query results.
Submit another query.