DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30A and Naa60

DIOPT Version :9

Sequence 1:NP_726727.1 Gene:Naa30A / 31079 FlyBaseID:FBgn0024362 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_996032.1 Gene:Naa60 / 39142 FlyBaseID:FBgn0036039 Length:276 Species:Drosophila melanogaster


Alignment Length:215 Identity:44/215 - (20%)
Similarity:71/215 - (33%) Gaps:94/215 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 EAEH----QMHDIMR--LIQAELSE-------------PYSIY-----TYRYF----IYNWPKLC 271
            :.||    .::|:..  |:..:|:|             |.|.|     :.|:|    :||     
  Fly    22 DCEHVPLCSINDVQLRFLVPDDLTEVRQLCQEWFPIDYPLSWYEDITSSTRFFALAAVYN----- 81

  Fly   272 FLASHDNQYVGAIVCKLDMHMNVRR-------------------------------------GYI 299
             ||     .:|.||.::..:.||.:                                     |||
  Fly    82 -LA-----IIGLIVAEIKPYRNVNKEVIANMSDSDELYTRLSGFPMQDKGILPDSMGRSADVGYI 140

  Fly   300 AMLAVRKEYRKLKIGTTLVTKAIEAMLA---DNADEVVLETEMRNQPALRLYENLGFV------- 354
            ..|.|.:.:|:..||:.|:...:..:..   .:...:.|.|...||||:..||...|.       
  Fly   141 LSLGVHRSHRRNGIGSLLLDALMNHLTTAERHSVKAIFLHTLTTNQPAIFFYEKRRFTLHSFLPY 205

  Fly   355 ------RDKRLFRY--YLNG 366
                  :.|..|.|  |:||
  Fly   206 YYNIRGKGKDGFTYVNYING 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30ANP_726727.1 rimI 242..370 CDD:273701 42/204 (21%)
Acetyltransf_1 276..354 CDD:278980 22/117 (19%)
Naa60NP_996032.1 RimI 74..207 CDD:223532 28/143 (20%)
Acetyltransf_1 <136..198 CDD:278980 17/61 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.