DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30A and Naa20A

DIOPT Version :10

Sequence 1:NP_726727.1 Gene:Naa30A / 31079 FlyBaseID:FBgn0024362 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001259714.1 Gene:Naa20A / 32962 FlyBaseID:FBgn0031043 Length:180 Species:Drosophila melanogaster


Alignment Length:119 Identity:34/119 - (28%)
Similarity:59/119 - (49%) Gaps:1/119 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 LSEPYSIYTYRYFIYNWPKLCFLA-SHDNQYVGAIVCKLDMHMNVRRGYIAMLAVRKEYRKLKIG 314
            |:|.|.:..|..::..||:...|| |...|.:|.|:.|::.|::...|::..|.|..:||:|.:.
  Fly    23 LTETYGLSFYTQYLAKWPEYFQLAESPSGQIMGYIMGKVEGHLDNWHGHVTALTVSPDYRRLGLA 87

  Fly   315 TTLVTKAIEAMLADNADEVVLETEMRNQPALRLYENLGFVRDKRLFRYYLNGVD 368
            ..|::...:......|..|.|.....||.|:.:|.|||::..:.:..||....|
  Fly    88 ALLMSFLEDISEKKRAYFVDLFVRKSNQVAINMYTNLGYIIYRTILEYYSGDQD 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30ANP_726727.1 Acetyltransf_1 240..353 CDD:395465 30/102 (29%)
Naa20ANP_001259714.1 RimI 55..152 CDD:440224 24/87 (28%)

Return to query results.
Submit another query.