DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30A and Naa20B

DIOPT Version :9

Sequence 1:NP_726727.1 Gene:Naa30A / 31079 FlyBaseID:FBgn0024362 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001285885.1 Gene:Naa20B / 318982 FlyBaseID:FBgn0051851 Length:204 Species:Drosophila melanogaster


Alignment Length:151 Identity:42/151 - (27%)
Similarity:76/151 - (50%) Gaps:17/151 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 MHDIMR---LIQAELSEPYSIYTYRYFIYNWPKLCFLA-SHDNQYVGAIV-CKLD---------M 290
            :.|:.:   ::...|:|.||:......|...|:|...| :.||..:|.|: .:::         .
  Fly     9 LEDLFKFNNIVMDPLAEVYSLPFLLPKILEHPELVLAADAPDNSLMGFILGTRVEDATESFGDAK 73

  Fly   291 HMNVRRGYIAMLAVRKEYRKLKIGTTLVTKAIEAMLADNADEVVLETEMRNQPALRLYENLGFVR 355
            .|....|:|:.|||.::||||.:||.|:|...:.|.......:.|....:|..|:.|||:||:|:
  Fly    74 TMTWNHGHISALAVAQDYRKLGLGTRLLTTVRDMMDRQKDFYIDLFVREKNTIAIGLYESLGYVK 138

  Fly   356 DKRLFRYYL--NGVDALRLKL 374
            .:.:.::|.  :|.: :||.|
  Fly   139 YRWIPKFYADDHGYE-MRLPL 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30ANP_726727.1 rimI 242..370 CDD:273701 39/143 (27%)
Acetyltransf_1 276..354 CDD:278980 27/87 (31%)
Naa20BNP_001285885.1 RimI <27..158 CDD:223532 38/131 (29%)
Acetyltransf_1 50..137 CDD:278980 27/86 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466529
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.