DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30A and CG31730

DIOPT Version :9

Sequence 1:NP_726727.1 Gene:Naa30A / 31079 FlyBaseID:FBgn0024362 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_723799.1 Gene:CG31730 / 318920 FlyBaseID:FBgn0051730 Length:162 Species:Drosophila melanogaster


Alignment Length:136 Identity:37/136 - (27%)
Similarity:63/136 - (46%) Gaps:11/136 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 EHQMHDIMR---LIQAELSEPYSIYTYRYFIYNWPKLCFLA---SHDNQYVGAIVCKLDMHMNV- 294
            |.:..|:.:   |:...|:|.||:..:......:|.|..:|   ..|.:.:|.|..:..:..|. 
  Fly     6 EMRFDDLFKINSLVFDALTEVYSLTFFVKHFLEFPGLSQIAIAPGPDGRPMGYIFGQYQVKRNQD 70

  Fly   295 RRGYIAMLAVRKEYRKLKIGTTLVTKAIEAMLAD--NADEVVLETEMRNQPALRLYENLGFVRDK 357
            ..|::|.|.|..|||:|.:.|.|:.  ...|::|  .|..|.|...:.|:.|.:||.:||:...:
  Fly    71 PYGHVAALTVSPEYRRLGLATALMD--FFFMVSDLKGASYVNLFMRISNRAAYQLYTSLGYAHRQ 133

  Fly   358 RLFRYY 363
            ....||
  Fly   134 TFLDYY 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30ANP_726727.1 rimI 242..370 CDD:273701 36/131 (27%)
Acetyltransf_1 276..354 CDD:278980 25/80 (31%)
CG31730NP_723799.1 rimI 9..141 CDD:273701 36/133 (27%)
Acetyltransf_1 52..129 CDD:278980 24/78 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466530
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.