DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30A and Naa30B

DIOPT Version :9

Sequence 1:NP_726727.1 Gene:Naa30A / 31079 FlyBaseID:FBgn0024362 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_728606.1 Gene:Naa30B / 317976 FlyBaseID:FBgn0052319 Length:211 Species:Drosophila melanogaster


Alignment Length:178 Identity:90/178 - (50%)
Similarity:115/178 - (64%) Gaps:3/178 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 QPPSDYAEGATPTITAQLQLPE--PAISADEIVYKEYEAEHQMHDIMRLIQAELSEPYSIYTYRY 262
            |...|......|....::.|||  .|..::.|.:..:..|.|:..:|.||..|||||||||||||
  Fly    21 QEKMDLVTKNLPLFAEKIVLPENDTAAKSEGIHFCVFHDESQLKVLMGLIDKELSEPYSIYTYRY 85

  Fly   263 FIYNWPKLCFLASHDNQYVGAIVCKLDMHMN-VRRGYIAMLAVRKEYRKLKIGTTLVTKAIEAML 326
            |:||||.|||.|...::|||.|||||:...: ..:||||||||..||||..||..|...||:||.
  Fly    86 FVYNWPDLCFFALDGDRYVGVIVCKLEAKRDGYLQGYIAMLAVDAEYRKRGIGRALSEMAIDAMA 150

  Fly   327 ADNADEVVLETEMRNQPALRLYENLGFVRDKRLFRYYLNGVDALRLKL 374
            ..:|..:|||||:.|:|||.||::|||:|::|..||||||:||..|||
  Fly   151 IRDAAMIVLETELSNKPALALYQSLGFIRERRFLRYYLNGMDAFHLKL 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30ANP_726727.1 rimI 242..370 CDD:273701 76/128 (59%)
Acetyltransf_1 276..354 CDD:278980 41/78 (53%)
Naa30BNP_728606.1 rimI 70..194 CDD:273701 74/123 (60%)
Acetyltransf_1 99..177 CDD:278980 40/77 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466838
Domainoid 1 1.000 96 1.000 Domainoid score I2459
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S678
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1323575at2759
OrthoFinder 1 1.000 - - FOG0002360
OrthoInspector 1 1.000 - - otm46581
orthoMCL 1 0.900 - - OOG6_101962
Panther 1 1.100 - - P PTHR45896
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3472
SonicParanoid 1 1.000 - - X2923
1110.830

Return to query results.
Submit another query.