DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30A and naa30

DIOPT Version :9

Sequence 1:NP_726727.1 Gene:Naa30A / 31079 FlyBaseID:FBgn0024362 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_596246.1 Gene:naa30 / 2539835 PomBaseID:SPBC15D4.06 Length:150 Species:Schizosaccharomyces pombe


Alignment Length:140 Identity:72/140 - (51%)
Similarity:97/140 - (69%) Gaps:2/140 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 HQ-MHDIMRLIQAELSEPYSIYTYRYFIYNWPKLCFLASHDNQYVGAIVCKLDMHMNVR-RGYIA 300
            || :.||.:|||.:||||||.|.||||::.||:..|:|..:::::||::||.|:|.... |||||
pombe     9 HQYLKDICQLIQKDLSEPYSKYVYRYFVHQWPEFSFVALDNDRFIGAVICKQDVHRGTTLRGYIA 73

  Fly   301 MLAVRKEYRKLKIGTTLVTKAIEAMLADNADEVVLETEMRNQPALRLYENLGFVRDKRLFRYYLN 365
            |||:.||||...|.|.|...:::.|....|.|:|||||:.|:.|:..||.|||.|.|||:|||||
pombe    74 MLAIVKEYRGQGIATKLTQASLDVMKNRGAQEIVLETEVDNEAAMSFYERLGFCRYKRLYRYYLN 138

  Fly   366 GVDALRLKLW 375
            |.||.|..|:
pombe   139 GTDAFRYILY 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30ANP_726727.1 rimI 242..370 CDD:273701 67/128 (52%)
Acetyltransf_1 276..354 CDD:278980 35/78 (45%)
naa30NP_596246.1 RimI 1..150 CDD:223532 72/140 (51%)
Acetyltransf_1 48..126 CDD:278980 34/77 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 106 1.000 Domainoid score I1684
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002360
OrthoInspector 1 1.000 - - otm47057
orthoMCL 1 0.900 - - OOG6_101962
Panther 1 1.100 - - LDO PTHR45896
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3472
SonicParanoid 1 1.000 - - X2923
TreeFam 00.000 Not matched by this tool.
87.940

Return to query results.
Submit another query.