DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30A and F54E7.9

DIOPT Version :9

Sequence 1:NP_726727.1 Gene:Naa30A / 31079 FlyBaseID:FBgn0024362 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_498219.1 Gene:F54E7.9 / 175784 WormBaseID:WBGene00018831 Length:167 Species:Caenorhabditis elegans


Alignment Length:164 Identity:32/164 - (19%)
Similarity:62/164 - (37%) Gaps:31/164 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 ATPTITAQLQLPEPAISADEIVYKEYEAEHQMHDIMRLIQAELSEPYSIYTYRYFIYNWPKLCFL 273
            ::|:....|:|....::|:.|           ..:..|:.:.....||...|:..:.|  :|..:
 Worm    10 SSPSTDNSLELRLQRVTAENI-----------KTVRILVSSIFPVSYSDKFYQECMNN--ELTGV 61

  Fly   274 ASHDNQYVGAIVCKLDMHMNVRRGYIAMLAVRKEYRKLKIGTTLVTKAIEAMLADNADE------ 332
            ...:.:.:..:..|.:.....|..||....|...:|:..:|         :.|.|..||      
 Worm    62 VIRNGEAIAIVAVKPENFETGRVLYIRSFGVHPRHREAGLG---------SFLMDFVDEKGKLLK 117

  Fly   333 ---VVLETEMRNQPALRLYENLGFVRDKRLFRYY 363
               .:|..:..|:.|:..|:|.||..|..:.:||
 Worm   118 LPHAMLHVQTSNKTAIEFYKNRGFNVDCLVPQYY 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30ANP_726727.1 rimI 242..370 CDD:273701 27/131 (21%)
Acetyltransf_1 276..354 CDD:278980 17/86 (20%)
F54E7.9NP_498219.1 Acetyltransf_1 30..141 CDD:366181 23/132 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.