DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30A and NAA30

DIOPT Version :9

Sequence 1:NP_726727.1 Gene:Naa30A / 31079 FlyBaseID:FBgn0024362 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001011713.2 Gene:NAA30 / 122830 HGNCID:19844 Length:362 Species:Homo sapiens


Alignment Length:371 Identity:149/371 - (40%)
Similarity:191/371 - (51%) Gaps:39/371 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PNHNPNSSGQVEAQTP----------SNGHVQHQEEEATEDQEPA-QELRGLLKKMHLCNGHGHK 78
            |...|.:...||.:.|          |......:|.|....:.|| .|...:..|.|.|......
Human    13 PPPAPPAPAAVEPRCPFPAGAALACCSEDEEDDEEHEGGGSRSPAGGESATVAAKGHPCLRCPQP 77

  Fly    79 EQEARPLGEVVNGHAHGHSNNNHIRCTSGSSNNNNSTHNNNSVDSSNNNRKQRREGGDGGGSDSN 143
            .||.:.|..:::...      .|:|..:...:...|. ...:..::..:...|.....|.|..|.
Human    78 PQEQQQLNGLISPEL------RHLRAAASLKSKVLSV-AEVAATTATPDGGPRATATKGAGVHSG 135

  Fly   144 SLKPEEKPITATSKTTANIHPTTTTDPKPKVSEDVAVEQGVHVATGSGHSREQERKQPPSDYAEG 208
            ...|......|.:...:.:.....:||       .|...|  :|.|:....|:|.:|     ...
Human   136 ERPPHSLSSNARTAVPSPVEAAAASDP-------AAARNG--LAEGTEQEEEEEDEQ-----VRL 186

  Fly   209 ATPTITAQLQLPEPA---ISADE---IVYKEYEAEHQMHDIMRLIQAELSEPYSIYTYRYFIYNW 267
            .:.::||...|..|:   :...|   |.|..||:|.||.||||||..:||||||||||||||:||
Human   187 LSSSLTADCSLRSPSGREVEPGEDRTIRYVRYESELQMPDIMRLITKDLSEPYSIYTYRYFIHNW 251

  Fly   268 PKLCFLASHDNQYVGAIVCKLDMHMNV-RRGYIAMLAVRKEYRKLKIGTTLVTKAIEAMLADNAD 331
            |:|||||....:.|||||||||||..: ||||||||||..:||:..|||.||.|||.||:..:.|
Human   252 PQLCFLAMVGEECVGAIVCKLDMHKKMFRRGYIAMLAVDSKYRRNGIGTNLVKKAIYAMVEGDCD 316

  Fly   332 EVVLETEMRNQPALRLYENLGFVRDKRLFRYYLNGVDALRLKLWFR 377
            |||||||:.|:.||:|||||||||||||||||||||||||||||.|
Human   317 EVVLETEITNKSALKLYENLGFVRDKRLFRYYLNGVDALRLKLWLR 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30ANP_726727.1 rimI 242..370 CDD:273701 94/128 (73%)
Acetyltransf_1 276..354 CDD:278980 50/78 (64%)
NAA30NP_001011713.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26 4/12 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..88 12/49 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..182 14/77 (18%)
RimI 209..362 CDD:223532 109/152 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157583
Domainoid 1 1.000 145 1.000 Domainoid score I4598
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 218 1.000 Inparanoid score I3594
Isobase 1 0.950 - 0 Normalized mean entropy S678
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1323575at2759
OrthoFinder 1 1.000 - - FOG0002360
OrthoInspector 1 1.000 - - oto91393
orthoMCL 1 0.900 - - OOG6_101962
Panther 1 1.100 - - LDO PTHR45896
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3472
SonicParanoid 1 1.000 - - X2923
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.880

Return to query results.
Submit another query.