DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30A and naa30

DIOPT Version :9

Sequence 1:NP_726727.1 Gene:Naa30A / 31079 FlyBaseID:FBgn0024362 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_004917281.2 Gene:naa30 / 100379895 XenbaseID:XB-GENE-877040 Length:311 Species:Xenopus tropicalis


Alignment Length:328 Identity:136/328 - (41%)
Similarity:168/328 - (51%) Gaps:67/328 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 EPAQELRGLLKKMHLCNGHGHKEQEARPLGEVVNGHAHGHSNN------NHIRCTSGSSNNNNST 115
            :|.:|..|        :|...:.:..|...|...||.|...|.      .|::..|         
 Frog    44 DPGEEQEG--------DGEEEEGRHGRETPEGFKGHHHHQLNGLISPDLRHLKAVS--------- 91

  Fly   116 HNNNSVDSSNNNRKQRREGGDGGGSDSNSLKPEEKPITATSKTTANIHPTTTTDPKPKVSEDVAV 180
                  ...|...:|.|:       |:...:.:|:        ||.|.|                
 Frog    92 ------SLKNKLLEQARK-------DAGLAQHDER--------TAAIAP---------------- 119

  Fly   181 EQGVHVATGSGHSREQERKQPPSDYAEGATPTITAQLQLPEPAISADEIVYKEYEAEHQMHDIMR 245
             .|:....|     |:|.::........|......:......:...|.|.|..||:|.||.||||
 Frog   120 -NGLERVQG-----EEEEEEESLSACLAACTLRGGEAHSNHVSQGDDTIRYVRYESELQMPDIMR 178

  Fly   246 LIQAELSEPYSIYTYRYFIYNWPKLCFLASHDNQYVGAIVCKLDMHMNV-RRGYIAMLAVRKEYR 309
            ||..:||||||||||||||:|||:|||||....:.|||||||||||..: ||||||||||..:||
 Frog   179 LITRDLSEPYSIYTYRYFIHNWPQLCFLAMVGEECVGAIVCKLDMHKKMFRRGYIAMLAVDSKYR 243

  Fly   310 KLKIGTTLVTKAIEAMLADNADEVVLETEMRNQPALRLYENLGFVRDKRLFRYYLNGVDALRLKL 374
            :..|||.||.|||.||:..:.||||||||:.|:.||:||||||||||||||||||||||||||||
 Frog   244 RKGIGTNLVKKAIYAMVEGDCDEVVLETEITNKSALKLYENLGFVRDKRLFRYYLNGVDALRLKL 308

  Fly   375 WFR 377
            |.|
 Frog   309 WLR 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30ANP_726727.1 rimI 242..370 CDD:273701 94/128 (73%)
Acetyltransf_1 276..354 CDD:278980 50/78 (64%)
naa30XP_004917281.2 RimI 161..311 CDD:223532 108/149 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 145 1.000 Domainoid score I4560
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1323575at2759
OrthoFinder 1 1.000 - - FOG0002360
OrthoInspector 1 1.000 - - oto105162
Panther 1 1.100 - - LDO PTHR45896
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3472
SonicParanoid 1 1.000 - - X2923
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.050

Return to query results.
Submit another query.