DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DAAM and diaph3

DIOPT Version :9

Sequence 1:NP_001188522.1 Gene:DAAM / 31075 FlyBaseID:FBgn0025641 Length:1463 Species:Drosophila melanogaster
Sequence 2:NP_001003624.1 Gene:diaph3 / 445230 ZFINID:ZDB-GENE-040801-144 Length:267 Species:Danio rerio


Alignment Length:313 Identity:63/313 - (20%)
Similarity:105/313 - (33%) Gaps:114/313 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 GGSDQQQSQSNHENGLGSEAGSFYTHNILGYTFGYPFGLKEDLDGSGNCNSNCNGSSNTNGLGLR 285
            |.|..::::.|.:.|.|:..                              |:..|||..:|....
Zfish    11 GSSQGRENKFNRKKGFGAGV------------------------------SSQGGSSGDDGEKKP 45

  Fly   286 KWLSGNTSSNETPLQKHYR----HQQKKKMPGFRGRRVWCGCFKDDEPPEICVVEGAFTLQTLTP 346
            |:|. ..||...|..|..|    |..|....|     .|....:.:|                 .
Zfish    46 KFLD-RFSSIRIPGSKKERPNLSHMSKHSSSG-----DWSSSSEFEE-----------------L 87

  Fly   347 TQPMPSVDELDTKFAELVEELDLTAPNKEAMLSLPAQKKWQIYCSRKLPLDAADGPDAAAVTQPP 411
            :..:.|..|:...|.:::|:::|   |:|                :|.||...|           
Zfish    88 SSRITSEKEILALFEKMMEDMNL---NEE----------------KKAPLREKD----------- 122

  Fly   412 TAEHYIERLKELVVH----------ISLSPEDSPSHELGNRLDGHA-----AFVDALKTALRTST 461
                 :...:|:|:.          :..|.:.||...|.....|..     |.:|:|:.:|.::.
Zfish   123 -----LNTKREMVLQYIVTAAKTGSLRSSSQISPQEFLSELKSGATDERLFACLDSLRVSLTSNP 182

  Fly   462 HSFVLRFVELDGLPALLDLLLQLDI-----RVANSPLHTSLIGCIKALMNNSM 509
            .|:|..|.. :||..|||.|.:|.:     :|.....| .:|.|:||.|||.:
Zfish   183 VSWVQSFGH-EGLGLLLDTLEKLLLKKHQEKVDKKSQH-KVIQCLKAFMNNKV 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DAAMNP_001188522.1 Drf_GBD 349..548 CDD:283920 41/181 (23%)
Drf_FH3 551..737 CDD:283917
FliJ 779..>875 CDD:280262
FH2 950..1328 CDD:280362
diaph3NP_001003624.1 Drf_GBD 93..>233 CDD:283920 41/176 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1204639at2759
OrthoFinder 1 1.000 - - FOG0000085
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3069
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.