DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DAAM and AT3G25493

DIOPT Version :9

Sequence 1:NP_001188522.1 Gene:DAAM / 31075 FlyBaseID:FBgn0025641 Length:1463 Species:Drosophila melanogaster
Sequence 2:NP_001326334.1 Gene:AT3G25493 / 28719318 AraportID:AT3G25493 Length:160 Species:Arabidopsis thaliana


Alignment Length:185 Identity:39/185 - (21%)
Similarity:63/185 - (34%) Gaps:39/185 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   765 LQIDVAKLVRLLVKEEQLTQARKRADELERENFDVQSRLAKKEQELDLRMQEKEDLETGLARMRE 829
            |.|.:..|..|.|.:|........:|:       |||.:.::...    .:..|.:||.|.|..|
plant     5 LAIHMGLLCILSVNDENTLSDHASSDQ-------VQSTITEESNS----QRFSESMETFLKRAEE 58

  Fly   830 RLEKESAQHSQAVQRAQTAEMRAEDLQHRLISEQQERARLERLVTE--GSIPDDQKVAGLTGCNG 892
            .:.:..||.|.|:...:..   .|........|:....|:..:|.:  |.:....|..|:.....
plant    59 EIIRVQAQESVALSLVKEI---TEYFHGNSAKEEAHPFRIFLVVRDFLGVVDRVCKEVGMINERT 120

  Fly   893 AVS-----PPPAPPMLKAIPPPPPPMAPSMMPPPPPPCPGAPPPPPSMAQTMAPA 942
            .||     |.|..||:                  |.|.||......|.:.:::.|
plant   121 MVSSAHKFPVPVNPMM------------------PQPLPGLVGRKQSSSSSLSAA 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DAAMNP_001188522.1 Drf_GBD 349..548 CDD:283920
Drf_FH3 551..737 CDD:283917
FliJ 779..>875 CDD:280262 19/95 (20%)
FH2 950..1328 CDD:280362
AT3G25493NP_001326334.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1204639at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.