DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DAAM and LOC101882656

DIOPT Version :9

Sequence 1:NP_001188522.1 Gene:DAAM / 31075 FlyBaseID:FBgn0025641 Length:1463 Species:Drosophila melanogaster
Sequence 2:XP_005174706.2 Gene:LOC101882656 / 101882656 -ID:- Length:315 Species:Danio rerio


Alignment Length:291 Identity:71/291 - (24%)
Similarity:144/291 - (49%) Gaps:42/291 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   982 DESKLY-NNMELESIDKLFSAYQKNGVSATDGSYEDLRVTGKAAKQKVLSVIDGRRAQNCTILLS 1045
            ||.:.| .|.|.:.:      ::..|:|              ..::.::.::||:|:|...||:|
Zfish     8 DEKRNYEKNYEFKGM------FKPPGLS--------------LVRKSIIKLLDGKRSQAVGILIS 52

  Fly  1046 KLKMSDMEISKAILSMDSNEQLQLDMVEQLLKFTPSAEERALLDEHSE-----DIESLARADRFL 1105
            .|.:...:|.:|:|::| :..:.|:.:|.|.:.....:|...:.:|.|     :::.|.:.::||
Zfish    53 SLHLEMKDIQQAVLTVD-HSVVDLETIEALYENRAQPDELEKIKKHYESSKEDELKLLDKPEQFL 116

  Fly  1106 YEISKIPHYEQRLKSLHYKKRFMLTINDLVPRITSVMEASREVARSRRLRKLLELVLALGNYMNR 1170
            ||:|:||.:..|...:.::..|:.:|:.:..::..:....:....:..::.::.::||.|||||.
Zfish   117 YELSQIPDFAGRSHCIIFQSVFVDSISSVCRKVEIISTVCKVFLDNDSVKDVIGVILAFGNYMNG 181

  Fly  1171 G--ARGNASGFRLASLNRLADTKSSAAKGTTLLHYLVQVIERKF-------KDLLKLED--DIPH 1224
            |  .||.|.||.|..|.:|.|.||...: .:|:.|:|....|..       |.:..|.:  |:.|
Zfish   182 GNRTRGQADGFGLEILPKLKDVKSRDNR-MSLVDYVVSYYLRNMDENAGTDKSVFPLPEPQDLFH 245

  Fly  1225 VREASKVSLGEMDKDIQMLRTGLADVAREIE 1255
               |::|...::.||::.|:..|....:|:|
Zfish   246 ---AAQVKFEDLAKDLRKLKKELTACVKEVE 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DAAMNP_001188522.1 Drf_GBD 349..548 CDD:283920
Drf_FH3 551..737 CDD:283917
FliJ 779..>875 CDD:280262
FH2 950..1328 CDD:280362 71/291 (24%)
LOC101882656XP_005174706.2 FH2 32..301 CDD:302999 64/247 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1204639at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.