DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and CNB1

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_012731.1 Gene:CNB1 / 853644 SGDID:S000001673 Length:175 Species:Saccharomyces cerevisiae


Alignment Length:183 Identity:42/183 - (22%)
Similarity:87/183 - (47%) Gaps:27/183 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TGLSAEQLEQLHTRFRSLDRHQRGYLTPTDLLRIPQLSLNPLHRQIIDGFFPSRDPSARIGFKQF 85
            |....:::|:|..||..|||...|.:...:.:.||.:|.|||..:|::.|  ..|.|..:.|::|
Yeast    16 TNFDRDEIERLRKRFMKLDRDSSGSIDKNEFMSIPGVSSNPLAGRIMEVF--DADNSGDVDFQEF 78

  Fly    86 VDTCSTILVPQFGRGSVRRRDGRVQKLQLLSKMFDTRRSGCITRSDFRQIMRSIVNLAWSQQQDQ 150
            :...|..    .||||      :.:||:...|::|..:.|.|:..:...:::.:|.         
Yeast    79 ITGLSIF----SGRGS------KDEKLRFAFKIYDIDKDGFISNGELFIVLKIMVG--------- 124

  Fly   151 ERQEGLSENRLPEVEAELQLLEHQAFGFCCDHISYGEFEKRLFSVDVDRRLSI 203
               ..|.:.:|.:: .:..::|:.:.|  ...:|:.||:..:.:.:|.:.|::
Yeast   125 ---SNLDDEQLQQI-VDRTIVENDSDG--DGRLSFEEFKNAIETTEVAKSLTL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 30/104 (29%)
EF-hand_6 117..139 CDD:290141 4/21 (19%)
CNB1NP_012731.1 FRQ1 4..161 CDD:227455 40/171 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.