DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and CML23

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_564874.1 Gene:CML23 / 842958 AraportID:AT1G66400 Length:157 Species:Arabidopsis thaliana


Alignment Length:136 Identity:26/136 - (19%)
Similarity:48/136 - (35%) Gaps:31/136 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QLCDHQQATGLSAEQLEQLHTRFRSLDRHQRGYLTPTDLLRIPQL----SLNPLHRQIIDGF-FP 72
            :|.|...|...:|.| |:.....:..|....|::...:.:.:.|:    |.|...|.:.:.| ..
plant    35 ELKDVIGALSPNASQ-EETKAMMKEFDLDGNGFIDLDEFVALFQISDQSSNNSAIRDLKEAFDLY 98

  Fly    73 SRDPSARIG-------FKQFVDTCSTILVPQFGRGSVRRRDGRVQKLQLLSKMFDTRRSGCITRS 130
            ..|.:.||.       .|...:.||                  :|..|.:....|:...||:...
plant    99 DLDRNGRISANELHSVMKNLGEKCS------------------IQDCQRMINKVDSDGDGCVDFE 145

  Fly   131 DFRQIM 136
            :|:::|
plant   146 EFKKMM 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 19/116 (16%)
EF-hand_6 117..139 CDD:290141 5/20 (25%)
CML23NP_564874.1 PTZ00184 13..152 CDD:185504 26/136 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.