DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and CBL2

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001332655.1 Gene:CBL2 / 835697 AraportID:AT5G55990 Length:226 Species:Arabidopsis thaliana


Alignment Length:133 Identity:27/133 - (20%)
Similarity:52/133 - (39%) Gaps:25/133 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TGLSAEQLEQLHTRFRSLDRH--QRGYLTPTDLLRIPQLSL---NPLHRQIIDGFFPSRDP--SA 78
            |..|..::|.|:..|:.:...  ..|.:...:.    ||:|   |.......|..|...|.  :.
plant    40 TVFSVSEIEALYELFKKISSAVIDDGLINKEEF----QLALFKTNKKESLFADRVFDLFDTKHNG 100

  Fly    79 RIGFKQFVDTCSTILVPQFGRGSVRRRDGRV-QKLQLLSKMFDTRRSGCITRSDFRQIMRSIVNL 142
            .:||::|....           ||...:..: .|:....:::|.::.|.|.|.:.:|::  :..|
plant   101 ILGFEEFARAL-----------SVFHPNAPIDDKIHFSFQLYDLKQQGFIERQEVKQMV--VATL 152

  Fly   143 AWS 145
            |.|
plant   153 AES 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 21/112 (19%)
EF-hand_6 117..139 CDD:290141 5/21 (24%)
CBL2NP_001332655.1 FRQ1 36..198 CDD:227455 27/133 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.