DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and SOS3

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001190377.1 Gene:SOS3 / 832494 AraportID:AT5G24270 Length:222 Species:Arabidopsis thaliana


Alignment Length:205 Identity:39/205 - (19%)
Similarity:75/205 - (36%) Gaps:75/205 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TGLSAEQLEQLHTRFRSLDR--------HQRGYLTPTDLLRIPQLSL-------NPLHRQIIDGF 70
            |..:.|::|.|:..|:.|..        |:..:          ||:|       |....:|.|.|
plant    29 TPFTVEEVEALYELFKKLSSSIIDDGLIHKEEF----------QLALFRNRNRRNLFADRIFDVF 83

  Fly    71 FPSRDPSARIGFKQFVDTCSTILVPQFGRGSVRRRDGRVQKLQLLSKMFDTRRSGCITRSDFRQI 135
            ...|  :..|.|.:||.:.. :..|.   ..|.      :|::...|::|.|::|.|.|.:.:::
plant    84 DVKR--NGVIEFGEFVRSLG-VFHPS---APVH------EKVKFAFKLYDLRQTGFIEREELKEM 136

  Fly   136 MRSIVNLAWSQQQDQERQEGLSENRLPEVEAELQLLEHQAFGFCCDHISYGEFEKRLFSVDVDR- 199
            :.::                |.|:.|...|..::::..:||                  |..|| 
plant   137 VVAL----------------LHESELVLSEDMIEVMVDKAF------------------VQADRK 167

  Fly   200 ---RLSIAKW 206
               ::.|.:|
plant   168 NDGKIDIDEW 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 25/119 (21%)
EF-hand_6 117..139 CDD:290141 6/21 (29%)
SOS3NP_001190377.1 FRQ1 29..187 CDD:227455 39/205 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.