DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and CBL3

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001320073.1 Gene:CBL3 / 828764 AraportID:AT4G26570 Length:230 Species:Arabidopsis thaliana


Alignment Length:183 Identity:31/183 - (16%)
Similarity:66/183 - (36%) Gaps:53/183 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TGLSAEQLEQLHTRFRSLDRH--QRGYLTPTDLLRIPQLSLNPLHR-----------QIIDGFFP 72
            |..|..::|.|:..|:.:...  ..|.:...:.    ||:|...::           |:.|.|  
plant    40 TVFSVSEIEALYELFKKISSAVIDDGLINKEEF----QLALFKTNKKESLFADRYQSQVFDLF-- 98

  Fly    73 SRDPSARIGFKQFVDTCSTILVPQFGRGSVRRRDGRVQ-KLQLLSKMFDTRRSGCITRSDFRQ-- 134
            ....:..:||::|....           ||...:..:: |:....:::|.::.|.|.|.:.:|  
plant    99 DTKHNGILGFEEFARAL-----------SVFHPNAPIEDKIDFSFQLYDLKQQGFIERQEVKQMV 152

  Fly   135 --------------IMRSIVNLAWSQQQDQERQEGLSENRLPEVEAELQLLEH 173
                          |:.||::..:      |..:...:.|:.:.|....:|.|
plant   153 VATLAESGMNLSDEIIESIIDKTF------EEADTKHDGRIDKEEWRTLVLRH 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 20/134 (15%)
EF-hand_6 117..139 CDD:290141 6/37 (16%)
CBL3NP_001320073.1 EFh_PEF 40..202 CDD:330173 31/183 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.