DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and AT4G03290

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_192238.1 Gene:AT4G03290 / 827993 AraportID:AT4G03290 Length:154 Species:Arabidopsis thaliana


Alignment Length:167 Identity:28/167 - (16%)
Similarity:59/167 - (35%) Gaps:57/167 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 TDLLRIPQLSLNPLHRQIIDGFFPSRDPSARIGFKQFVDTCST--ILVPQFGRGSVRRRDGRVQK 111
            |:|.|:.|:.              .:|...:|..|:..::...  |::|:             .:
plant     4 TELNRVFQMF--------------DKDGDGKITTKELNESFKNLGIIIPE-------------DE 41

  Fly   112 LQLLSKMFDTRRSGCITRSDFRQIMRSIVNLAWSQQQDQERQEGLSE---------------NRL 161
            |..:.:..|....||:...:|.::.::|:    .:.:|:..:|.:.|               :.|
plant    42 LTQIIQKIDVNGDGCVDIEEFGELYKTIM----VEDEDEVGEEDMKEAFNVFDRNGDGFITVDEL 102

  Fly   162 PEVEAELQLLEHQAFGFCCDHISYGEFEKRLFSVDVD 198
            ..|.:.|.|.:.:....|         .|.:..||||
plant   103 KAVLSSLGLKQGKTLEEC---------RKMIMQVDVD 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 14/88 (16%)
EF-hand_6 117..139 CDD:290141 4/21 (19%)
AT4G03290NP_192238.1 PTZ00184 5..144 CDD:185504 27/166 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.