DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and CBL1

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001329533.1 Gene:CBL1 / 827481 AraportID:AT4G17615 Length:252 Species:Arabidopsis thaliana


Alignment Length:205 Identity:40/205 - (19%)
Similarity:79/205 - (38%) Gaps:45/205 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NPVQLCDHQQATGLSAEQLEQLHTRFRSLDRH--QRGYLTPTDLLRIPQLSL-------NPLHRQ 65
            :||:|...   |..|..::|.|...|:|:...  ..|.:...:.    ||:|       |....:
plant    17 DPVKLASE---TAFSVSEVEALFELFKSISSSVVDDGLINKEEF----QLALFKSRKRENIFANR 74

  Fly    66 IIDGFFPSRDPSARIGFKQFVDTCSTILVPQFGRGSVRRRDGRVQKLQLLSKMFDTRRSGCITRS 130
            |.|.|...|  ...|.|..||.:.: :..|   ..|:.      .|:....:::|...:|.|.|.
plant    75 IFDMFDVKR--KGVIDFGDFVRSLN-VFHP---NASLE------DKIDFTFRLYDMDCTGYIERQ 127

  Fly   131 DFRQIMRSIVNLAWSQQQDQERQEGLSENRLPEVEAELQLLEHQAFGFCCDHISYGEFEKRLFSV 195
            :.:|::.::                |.|:.:...:..::::..:.|. ..|....|:.:|..:|.
plant   128 EVKQMLIAL----------------LCESEMKLADETIEIILDKTFE-DADVNQDGKIDKLEWSD 175

  Fly   196 DVDRRLSIAK 205
            .|::..|:.|
plant   176 FVNKNPSLLK 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 24/113 (21%)
EF-hand_6 117..139 CDD:290141 5/21 (24%)
CBL1NP_001329533.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.