DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and CBL6

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001328805.1 Gene:CBL6 / 827330 AraportID:AT4G16350 Length:226 Species:Arabidopsis thaliana


Alignment Length:137 Identity:27/137 - (19%)
Similarity:59/137 - (43%) Gaps:24/137 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DHQQATGLSAEQLEQLHTRFRSLDRHQRGYLTPTDLLRIPQLSLNPLHRQIIDGFFPSRDPSARI 80
            |..:.|..:..::|.|:..|:|:.::.   |...:..::....:|.......|..|         
plant    33 DVARGTVFTVNEIEALYELFKSISKNG---LIDKEQFQLVLFKMNTTRSLFADRVF--------- 85

  Fly    81 GFKQFVDTCSTILV--PQFGRG-SVRRRDGRVQ-KLQLLSKMFDTRRSGCITRSDFRQ-IMRSI- 139
               ...||.:|.::  ..|.|. ||...:.:.: |::...|::|..:.|.|.|.:.:| ::|:: 
plant    86 ---DLFDTKNTGILDFEAFARSLSVFHPNAKFEDKIEFSFKLYDLNQQGYIKRQEVKQMVVRTLA 147

  Fly   140 ---VNLA 143
               :||:
plant   148 ESGMNLS 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 21/109 (19%)
EF-hand_6 117..139 CDD:290141 7/22 (32%)
CBL6NP_001328805.1 FRQ1 38..192 CDD:227455 26/132 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.