DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and UNE14

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_193022.1 Gene:UNE14 / 826898 AraportID:AT4G12860 Length:152 Species:Arabidopsis thaliana


Alignment Length:114 Identity:22/114 - (19%)
Similarity:40/114 - (35%) Gaps:47/114 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EQLEQLHTRFRSLDRHQRGYLTPTDLLRIPQLSLNPLHRQIIDGFFPSRDPSARIGFKQ--FVDT 88
            |:.|.:...||..|::..|::|..:|                      |...|.:|.||  .::.
plant    74 EEEEDMREAFRVFDQNGDGFITDEEL----------------------RSVLASMGLKQGRTLED 116

  Fly    89 CSTILVPQFGRGSVRRRDGRVQKLQLLSKMFDTRRSGCITRSDFRQIMR 137
            |.                      :::||: |....|.:...:|:|:||
plant   117 CK----------------------KMISKV-DVDGDGMVNFKEFKQMMR 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 18/106 (17%)
EF-hand_6 117..139 CDD:290141 7/21 (33%)
UNE14NP_193022.1 PTZ00184 5..141 CDD:185504 20/111 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.