DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and AT3G59440

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_191503.1 Gene:AT3G59440 / 825113 AraportID:AT3G59440 Length:195 Species:Arabidopsis thaliana


Alignment Length:142 Identity:29/142 - (20%)
Similarity:48/142 - (33%) Gaps:58/142 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 DGRVQK-------------------LQLLSKMFDTRRSGCITRSDFRQIMRSIVNLAWSQQQDQE 151
            |||:.|                   :|::.|| |....||:..::|..:..|||         :|
plant    64 DGRITKEELNDSLENLGIFMPDKDLIQMIQKM-DANGDGCVDINEFESLYGSIV---------EE 118

  Fly   152 RQEG----------------LSENRLPEVEAELQLLEHQAFGFCC------------DHISYGEF 188
            ::||                ::...|..|...|.|.:.:... ||            ..::|.||
plant   119 KEEGDMRDAFNVFDQDGDGFITVEELNSVMTSLGLKQGKTLE-CCKEMIMQVDEDGDGRVNYKEF 182

  Fly   189 EKRLFSVDVDRR 200
            .:.:.|.|...|
plant   183 LQMMKSGDFSNR 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 11/48 (23%)
EF-hand_6 117..139 CDD:290141 6/21 (29%)
AT3G59440NP_191503.1 PTZ00184 41..188 CDD:185504 26/134 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.