DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and AT3G18430

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001189924.1 Gene:AT3G18430 / 821372 AraportID:AT3G18430 Length:175 Species:Arabidopsis thaliana


Alignment Length:136 Identity:38/136 - (27%)
Similarity:73/136 - (53%) Gaps:26/136 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EQLEQLHTRFRSLDRHQRGYLTPTDLLRIPQLSLNPLHRQI---IDGFFPSRDPSARIGFKQFVD 87
            :::..|:.||..|||:.:|:::..:.|.:|:.::|||.:::   :||          :.||.||.
plant    27 QEILSLYQRFCQLDRNAKGFISADEFLSVPEFAMNPLSQRLLKMVDG----------LNFKDFVA 81

  Fly    88 TCSTILVPQFGRGSVRRRDGRVQKLQLLSKMFDTRRSGCITRSDFRQIMRSIVNLAWSQQQDQER 152
            ..|..    ..:.|:|      ||:||:.|::|   |.|..:..|:.||..:.:|:.|...|::|
plant    82 FLSAF----SAKASLR------QKVQLIFKVYD---SDCNGKVSFKDIMEVLRDLSGSFMSDEQR 133

  Fly   153 QEGLSE 158
            ::.||:
plant   134 EQVLSQ 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 30/107 (28%)
EF-hand_6 117..139 CDD:290141 7/21 (33%)
AT3G18430NP_001189924.1 FRQ1 24..161 CDD:227455 38/136 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2564
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.