DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and AT3G18430

DIOPT Version :10

Sequence 1:NP_569899.3 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_566610.1 Gene:AT3G18430 / 821372 AraportID:AT3G18430 Length:175 Species:Arabidopsis thaliana


Alignment Length:136 Identity:38/136 - (27%)
Similarity:73/136 - (53%) Gaps:26/136 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EQLEQLHTRFRSLDRHQRGYLTPTDLLRIPQLSLNPLHRQI---IDGFFPSRDPSARIGFKQFVD 87
            :::..|:.||..|||:.:|:::..:.|.:|:.::|||.:::   :||          :.||.||.
plant    27 QEILSLYQRFCQLDRNAKGFISADEFLSVPEFAMNPLSQRLLKMVDG----------LNFKDFVA 81

  Fly    88 TCSTILVPQFGRGSVRRRDGRVQKLQLLSKMFDTRRSGCITRSDFRQIMRSIVNLAWSQQQDQER 152
            ..|..    ..:.|:|      ||:||:.|::|   |.|..:..|:.||..:.:|:.|...|::|
plant    82 FLSAF----SAKASLR------QKVQLIFKVYD---SDCNGKVSFKDIMEVLRDLSGSFMSDEQR 133

  Fly   153 QEGLSE 158
            ::.||:
plant   134 EQVLSQ 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_569899.3 FRQ1 25..>139 CDD:444056 32/115 (28%)
AT3G18430NP_566610.1 PTZ00183 24..160 CDD:185503 38/136 (28%)

Return to query results.
Submit another query.