DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and AGD11

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_187405.1 Gene:AGD11 / 819937 AraportID:AT3G07490 Length:153 Species:Arabidopsis thaliana


Alignment Length:170 Identity:32/170 - (18%)
Similarity:64/170 - (37%) Gaps:50/170 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 FRSLDRHQRGYLTPTDL--------LRIPQLSLNPLHRQII---DGFFPSRDPSARIGFKQFVDT 88
            |:..||:..|.:|..:|        :.||...|..:..:|.   ||:         :..::|...
plant    10 FQMFDRNGDGKITKQELNDSLENLGIYIPDKDLVQMIEKIDLNGDGY---------VDIEEFGGL 65

  Fly    89 CSTILVPQFGRGSVRRRDGRVQKLQLLSKMFDTRRSGCITRSDFRQIMRSIVNLAWSQQQDQERQ 153
            ..||:         ..|| ..:.::....:||..|.|.||..:.|.::.|:              
plant    66 YQTIM---------EERD-EEEDMREAFNVFDQNRDGFITVEELRSVLASL-------------- 106

  Fly   154 EGLSENR-LPEVEAELQLLEHQAFGFCCDHISYGEFEKRL 192
             ||.:.| |.:.:..:..::....|.    :::.||::.:
plant   107 -GLKQGRTLEDCKRMISKVDVDGDGM----VNFKEFKQMM 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 24/111 (22%)
EF-hand_6 117..139 CDD:290141 7/21 (33%)
AGD11NP_187405.1 PTZ00184 4..141 CDD:185504 32/168 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.