DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and Cib1

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:XP_038948271.1 Gene:Cib1 / 81823 RGDID:620133 Length:203 Species:Rattus norvegicus


Alignment Length:191 Identity:42/191 - (21%)
Similarity:75/191 - (39%) Gaps:34/191 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSVGSRQLNPVQLCDHQQATGLSAEQLEQLHTRF--------RSLDRHQRGYLTPTDLLRIPQL 57
            ||..||| |:...|.::|..|.|:.:::...|.||        |:::......::...:|.:|:|
  Rat     1 MGGSGSR-LSKELLAEYQDLTFLTKQEILLAHRRFCELLPPEHRTVEESLHTRVSFEQILSLPEL 64

  Fly    58 SLNPLHRQIIDGF--FPSRDPSARIGFKQFVDTCSTI---LVPQFGRGSVRRRDGRVQKLQLLSK 117
            ..||...:|...|  .|:||   .:.|:.|:|..|..   ..|..             |.....:
  Rat    65 KANPFKERICMVFSTSPTRD---SLSFEDFLDLLSVFSDTATPDI-------------KSHYAFR 113

  Fly   118 MFDTRRSGCITRSDFRQIMRSIVNLAWSQQQDQERQEGLSENRLPEVEAE----LQLLEHQ 174
            :||....|.:.|.|..:::..:.......:......:.|.:|.|.|.:.:    :.|.|.|
  Rat   114 IFDFDDDGTLDREDLSRLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQ 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 25/117 (21%)
EF-hand_6 117..139 CDD:290141 5/21 (24%)
Cib1XP_038948271.1 EFh 111..178 CDD:238008 12/64 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350464
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.