DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and tesc

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001072423.1 Gene:tesc / 779877 XenbaseID:XB-GENE-991111 Length:214 Species:Xenopus tropicalis


Alignment Length:224 Identity:58/224 - (25%)
Similarity:103/224 - (45%) Gaps:52/224 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SVGSRQLNPVQLCDHQQATGLSAEQLEQLHTRFRSLDRH----QRGYLTPTDLLRIPQLSLNPLH 63
            ||.:|||        .:.||.||||:|.||.||.||...    ::|:|.     .|..|.:||:.
 Frog     8 SVETRQL--------VEKTGFSAEQIEHLHKRFNSLSGDLLTIRKGHLN-----GISDLEVNPIR 59

  Fly    64 RQIIDGFFPSRDPS-------ARIGFKQFVDTCSTILVPQFGRG----------SVRRRDGRVQK 111
            .:|:|.||..|:..       ..|.|::|:    ||:  .:.|.          ||.|:|    |
 Frog    60 SKIVDAFFDKRNLRKGSSGYVEEINFEEFL----TIM--SYFRPLSQNMDEENISVCRKD----K 114

  Fly   112 LQLLSKMFDTRRSGCITRSDFRQIMRSIVNLAWSQQQDQERQEGLSENRLPEVEAEL--QLLEHQ 174
            |:.|..|:||.....||..::|:::..:  |:.:...::|....:::..:.|..:..  |:...|
 Frog   115 LRFLFNMYDTDNDSKITLEEYRKVVEEL--LSGNPNIEKETARSIADGAMLEAASICVGQMEPDQ 177

  Fly   175 AFGFCCDHISYGEFEKRLFSVDVDRRLSI 203
            .:    :.|::.:|.|....:|::.::.|
 Frog   178 VY----EGITFDDFLKIWEGIDIETKMHI 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 36/125 (29%)
EF-hand_6 117..139 CDD:290141 6/21 (29%)
tescNP_001072423.1 EFh_PEF 12..>142 CDD:330173 46/152 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.