DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and Chp2

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_081639.1 Gene:Chp2 / 70261 MGIID:1917511 Length:196 Species:Mus musculus


Alignment Length:213 Identity:58/213 - (27%)
Similarity:110/213 - (51%) Gaps:34/213 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VGSRQLNPVQLCD--H-QQATGLSAEQLEQLHTRFRSLDRHQRGYLTPTDLLRIPQLSLNPLHRQ 65
            :|||..:...:.|  | ::.||.|...|.:|:.||::|||.::|:|:..||.:|..|::|||..:
Mouse     1 MGSRSSHIALIPDVEHIRRETGFSQASLLRLYHRFQALDRDEKGFLSRLDLQQIGALAVNPLGDR 65

  Fly    66 IIDGFFPSRDPSARIGFKQFV----------DTCSTILVPQFGRGSVRRRDGRVQKLQLLSKMFD 120
            |||.|||  :.|.|:.|..|.          :..:|:..|:    .....:.|:.||:...:::|
Mouse    66 IIDSFFP--NGSQRLYFAGFARVLAYFRPIDEEDATLRDPK----QPEPLNSRMNKLRFAFQLYD 124

  Fly   121 TRRSGCITRSDFRQIMRSIVNLAWSQQQDQERQEGLSENRLPEVEAELQLLEHQAFGFCCDHISY 185
            ..|.|.|:|::..|::|.:|.:    |...|:.|.:::..:.|.:.:..           ..:|:
Mouse   125 LDRDGKISRNEMLQVLRLMVGV----QVTDEQLESITDRTVQEADEDGD-----------GAVSF 174

  Fly   186 GEFEKRLFSVDVDRRLSI 203
            .||.|.|..:::::::||
Mouse   175 LEFTKSLEKMNIEQKMSI 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 36/114 (32%)
EF-hand_6 117..139 CDD:290141 7/21 (33%)
Chp2NP_081639.1 FRQ1 23..179 CDD:227455 47/176 (27%)
Nuclear export signal. /evidence=ECO:0000250 137..148 3/14 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846974
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46002
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.