DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and Tescl

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001157282.1 Gene:Tescl / 69301 MGIID:1916551 Length:231 Species:Mus musculus


Alignment Length:203 Identity:49/203 - (24%)
Similarity:93/203 - (45%) Gaps:26/203 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 CDHQQATGLSAEQLEQLHTRFRSLDRHQRGYLTPTDLLRIPQLSLNPLHRQIIDGFFPSRD---- 75
            ||      .|.||::|||.|||.|...| ..|.|.....|..|..||:..:|:..||.:|:    
Mouse    31 CD------FSWEQIKQLHQRFRLLSGDQ-PTLQPESFDNILDLEFNPIRSRIVRAFFDNRNLGKG 88

  Fly    76 ---PSARIGFKQFVDTCSTI--LVPQFGRGSVRRRDGRVQKLQLLSKMFDTRRSGCITRSDFRQI 135
               .:..|.|:.|:...|..  |.|...:....:  .|..|::.|..|:|....|.||..::|::
Mouse    89 TSGLAEEITFQDFLTIISYFRPLRPSLNKEEAEQ--NRKDKMRFLFNMYDQDGDGIITLQEYRRV 151

  Fly   136 MRSIVNLAWSQQQDQERQ--EGLSENRLPEV--EAELQLLEHQAFGFCCDHISYGEFEKRLFSVD 196
            :.|:::.....::|..|.  ..:::..|.|.  .::..|:..|.:    :.|::.:|.|...|::
Mouse   152 VESLLSAHPQVERDTVRSVANAIAQGALKEAARASDQPLMAGQQY----EGITFEDFVKTWKSLE 212

  Fly   197 VDRRLSIA 204
            ::.::.::
Mouse   213 LEVKMQVS 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 32/113 (28%)
EF-hand_6 117..139 CDD:290141 6/21 (29%)
TesclNP_001157282.1 FRQ1 24..>155 CDD:227455 38/132 (29%)
EFh 127..>155 CDD:298682 8/27 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846949
Domainoid 1 1.000 47 1.000 Domainoid score I11966
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.710

Return to query results.
Submit another query.