DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and Cib4

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:XP_001068424.2 Gene:Cib4 / 688819 RGDID:1584147 Length:185 Species:Rattus norvegicus


Alignment Length:203 Identity:41/203 - (20%)
Similarity:77/203 - (37%) Gaps:52/203 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSVGSRQLNPVQLCDHQQATGLSAEQLEQLHTRFRSL----DRHQRGYLTPTDLLRIPQLSLNP 61
            ||.....|:....|.::|..|.|:..::..:|..|..|    ..::...||...:..:|.|.:||
  Rat     1 MGQCLRYQMQWEDLEEYQALTFLTRNEILCIHDTFLKLCPPGKHYKEATLTMDQVSSLPALRVNP 65

  Fly    62 LHRQIIDGFFPSRDPSARIGFKQFVDTCSTILVPQFGRGSVRRRDGRVQ-KLQLLSKMFDTRRSG 125
            .           ||...|:.....|.:...:|    |..||........ |::...:::|...:|
  Rat    66 F-----------RDRICRVFSHDDVFSFEDVL----GMASVFSEQACPSLKIEYAFRIYDFNENG 115

  Fly   126 CITRSDFRQIMRSIVNLAWSQQQDQERQEGLSENRLPEV------EAELQLLEHQAFGFCCDH-- 182
            .|...|.::|:..::           :.:.:||:.|.:|      |::|            |:  
  Rat   116 FIDEEDLQKIVLRLL-----------KSDDVSEDLLQDVTHHVLSESDL------------DNDN 157

  Fly   183 -ISYGEFE 189
             :|:.|||
  Rat   158 MLSFSEFE 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 22/109 (20%)
EF-hand_6 117..139 CDD:290141 5/21 (24%)
Cib4XP_001068424.2 FRQ1 21..173 CDD:227455 36/183 (20%)
EF-hand_7 101..168 CDD:404394 17/88 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350460
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.