DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and Chp1

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_077053.1 Gene:Chp1 / 64152 RGDID:620447 Length:195 Species:Rattus norvegicus


Alignment Length:211 Identity:57/211 - (27%)
Similarity:105/211 - (49%) Gaps:28/211 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSVGSRQLNPVQLCDHQQATGLSAEQLEQLHTRFRSLDRHQRGYLTPTDLLRIPQLSLNPLHRQ 65
            |||..|..|...:|.:.::.||.|..|:.:|::||.|||:.:.|.|:..|..|||:|::|||..:
  Rat     1 MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDR 65

  Fly    66 IIDGFFPSRDPSARIGFKQFVDTCSTILVPQFGRGSVRRRD--------GRVQKLQLLSKMFDTR 122
            ||:.||...:.  ::.|:.|:.|.:.....:   .:.:.:|        .|..||....:::|..
  Rat    66 IINAFFSEGED--QVNFRGFMRTLAHFRPIE---DNEKSKDVNGPEPLNSRSNKLHFAFRLYDLD 125

  Fly   123 RSGCITRSDFRQIMRSIVNLAWSQQQDQERQEGLSENRLPEVEAELQLLEHQAFGFCCDHISYGE 187
            :...|:|.:..|::|.:|.:..|.:|    ...:::..:.|.:.:..           ..||:.|
  Rat   126 KDDKISRDELLQVLRMMVGVNISDEQ----LGSIADRTIQEADQDGD-----------SAISFTE 175

  Fly   188 FEKRLFSVDVDRRLSI 203
            |.|.|..|||::::||
  Rat   176 FVKVLEKVDVEQKMSI 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 31/112 (28%)
EF-hand_6 117..139 CDD:290141 5/21 (24%)
Chp1NP_077053.1 FRQ1 1..182 CDD:227455 52/200 (26%)
Necessary for association with microtubule and interaction with GAPDH 2..6 2/3 (67%)
Nuclear export signal 1 138..147 2/8 (25%)
Nuclear export signal 2 176..185 4/8 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350456
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46002
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.