Sequence 1: | NP_001284770.1 | Gene: | CG32812 / 31074 | FlyBaseID: | FBgn0025642 | Length: | 225 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_067319.2 | Gene: | Tesc / 57816 | MGIID: | 1930803 | Length: | 214 | Species: | Mus musculus |
Alignment Length: | 196 | Identity: | 48/196 - (24%) |
---|---|---|---|
Similarity: | 92/196 - (46%) | Gaps: | 24/196 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 21 TGLSAEQLEQLHTRFRSLDRHQRGYLTPT----DLLRIPQLSLNPLHRQIIDGFFPSRD------ 75
Fly 76 -PSARIGFKQFVDTCSTILVPQFGRGSVRRRDGRVQKLQLLSKMFDTRRSGCITRSDFRQIMRSI 139
Fly 140 VNLAWSQQQDQERQEGLSENRLPEVEAEL--QLLEHQAFGFCCDHISYGEFEKRLFSVDVDRRLS 202
Fly 203 I 203 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32812 | NP_001284770.1 | EF-hand_7 | 31..136 | CDD:290234 | 32/115 (28%) |
EF-hand_6 | 117..139 | CDD:290141 | 6/21 (29%) | ||
Tesc | NP_067319.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..20 | 1/1 (100%) | |
FRQ1 | 20..>142 | CDD:227455 | 36/126 (29%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167846946 | |
Domainoid | 1 | 1.000 | 47 | 1.000 | Domainoid score | I11966 |
eggNOG | 1 | 0.900 | - | - | E2759_KOG0034 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1271942at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 1 | 0.960 | - | - | ||
7 | 6.710 |