DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and Tesc

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_067319.2 Gene:Tesc / 57816 MGIID:1930803 Length:214 Species:Mus musculus


Alignment Length:196 Identity:48/196 - (24%)
Similarity:92/196 - (46%) Gaps:24/196 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TGLSAEQLEQLHTRFRSLDRHQRGYLTPT----DLLRIPQLSLNPLHRQIIDGFFPSRD------ 75
            ||.|::|:||||.||:.|...|     ||    :...:|.|.|||:..:|:..||.:|:      
Mouse    18 TGFSSDQIEQLHRRFKQLSGDQ-----PTIRKENFNNVPDLELNPIRSKIVRAFFDNRNLRKGSS 77

  Fly    76 -PSARIGFKQFVDTCSTILVPQFGRGSVRRRDGRVQKLQLLSKMFDTRRSGCITRSDFRQIMRSI 139
             .:..|.|:.|:...|.........|..:....|.:||:.|..|:|:...|.||..::|.::..:
Mouse    78 GLADEINFEDFLTIMSYFRPIDTTLGEEQVELSRKEKLKFLFHMYDSDSDGRITLEEYRNVVEEL 142

  Fly   140 VNLAWSQQQDQERQEGLSENRLPEVEAEL--QLLEHQAFGFCCDHISYGEFEKRLFSVDVDRRLS 202
              |:.:...::|....:::..:.|..:..  |:...|.:    :.|::.:|.|....:|::.::.
Mouse   143 --LSGNPHIEKESARSIADGAMMEAASVCVGQMEPDQVY----EGITFEDFLKIWQGIDIETKMH 201

  Fly   203 I 203
            |
Mouse   202 I 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 32/115 (28%)
EF-hand_6 117..139 CDD:290141 6/21 (29%)
TescNP_067319.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 1/1 (100%)
FRQ1 20..>142 CDD:227455 36/126 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846946
Domainoid 1 1.000 47 1.000 Domainoid score I11966
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.710

Return to query results.
Submit another query.