DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and ppp3r1a

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:XP_009305321.1 Gene:ppp3r1a / 564337 ZFINID:ZDB-GENE-081113-3 Length:175 Species:Danio rerio


Alignment Length:182 Identity:38/182 - (20%)
Similarity:84/182 - (46%) Gaps:33/182 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 AEQLEQLHTRFRSLDRHQRGYLTPTDLLRIPQLSLNPLHRQIIDGFFPSRDPSARIGFKQFVDTC 89
            |:::::|..||:.||....|.|:..:.:.:|:|..|||.:::||.|  ..|.:..:.||:|::..
Zfish    22 ADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIF--DTDGNGEVDFKEFIEGV 84

  Fly    90 STILVPQFGRGSVRRRDGRVQKLQLLSKMFDTRRSGCITRSDFRQIMRSIVNLAWSQQQDQERQE 154
            |...|          :..:..||:...:::|..:.|.|:..:..|:::.:|.             
Zfish    85 SQFSV----------KGDKEMKLRFAFRIYDMDKDGYISNGELFQVLKMMVG------------- 126

  Fly   155 GLSENRLPEVEAELQLLEHQAFGFCCD---HISYGEFEKRLFSVDVDRRLSI 203
                |.|.:.:.: |:::........|   .||:.||...:..:|:.:::.:
Zfish   127 ----NNLKDTQLQ-QIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVV 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 27/104 (26%)
EF-hand_6 117..139 CDD:290141 4/21 (19%)
ppp3r1aXP_009305321.1 FRQ1 14..162 CDD:227455 37/169 (22%)
EFh 30..85 CDD:238008 18/56 (32%)
EFh 96..162 CDD:238008 15/83 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.