DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and Chp1

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_062743.1 Gene:Chp1 / 56398 MGIID:1927185 Length:195 Species:Mus musculus


Alignment Length:211 Identity:57/211 - (27%)
Similarity:105/211 - (49%) Gaps:28/211 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSVGSRQLNPVQLCDHQQATGLSAEQLEQLHTRFRSLDRHQRGYLTPTDLLRIPQLSLNPLHRQ 65
            |||..|..|...:|.:.::.||.|..|:.:|::||.|||:.:.|.|:..|..|||:|::|||..:
Mouse     1 MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDR 65

  Fly    66 IIDGFFPSRDPSARIGFKQFVDTCSTILVPQFGRGSVRRRD--------GRVQKLQLLSKMFDTR 122
            ||:.||...:.  ::.|:.|:.|.:.....:   .:.:.:|        .|..||....:::|..
Mouse    66 IINAFFSEGED--QVNFRGFMRTLAHFRPIE---DNEKSKDVNGPEPLNSRSNKLHFAFRLYDLD 125

  Fly   123 RSGCITRSDFRQIMRSIVNLAWSQQQDQERQEGLSENRLPEVEAELQLLEHQAFGFCCDHISYGE 187
            :...|:|.:..|::|.:|.:..|.:|    ...:::..:.|.:.:..           ..||:.|
Mouse   126 KDDKISRDELLQVLRMMVGVNISDEQ----LGSIADRTIQEADQDGD-----------SAISFTE 175

  Fly   188 FEKRLFSVDVDRRLSI 203
            |.|.|..|||::::||
Mouse   176 FVKVLEKVDVEQKMSI 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 31/112 (28%)
EF-hand_6 117..139 CDD:290141 5/21 (24%)
Chp1NP_062743.1 Nuclear export signal 2. /evidence=ECO:0000250 176..185 4/8 (50%)
FRQ1 1..182 CDD:227455 52/200 (26%)
Necessary for association with microtubule and interaction with GAPDH. /evidence=ECO:0000250 2..6 2/3 (67%)
Nuclear export signal 1. /evidence=ECO:0000250 138..147 2/8 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846957
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S676
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46002
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.