DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and si:ch211-245j22.3

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001074270.1 Gene:si:ch211-245j22.3 / 563798 ZFINID:ZDB-GENE-050419-38 Length:194 Species:Danio rerio


Alignment Length:120 Identity:28/120 - (23%)
Similarity:50/120 - (41%) Gaps:48/120 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SAEQLEQLHTRFRSLDRHQRGYLTPTDLLRIPQLSLNPLHRQIIDGFFPSRDPSARIGFKQFVDT 88
            |||..||:   ||:||.:..|                     ::|             |:::|..
Zfish    53 SAEYAEQI---FRTLDNNGDG---------------------VVD-------------FREYVTA 80

  Fly    89 CSTILVPQFGRGSVRRRDGRVQKLQLLSKMFDTRRSGCITRSDFRQIMRSIVNLA 143
            .|.::     .||.      |:||:...|::|..:.|.||||:..:||:::..::
Zfish    81 ISMLI-----EGST------VEKLRWSFKLYDKDKDGAITRSEMLEIMQAVYKMS 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 21/104 (20%)
EF-hand_6 117..139 CDD:290141 9/21 (43%)
si:ch211-245j22.3NP_001074270.1 EF-hand_8 31..78 CDD:290545 12/61 (20%)
EF-hand_7 32..81 CDD:290234 13/64 (20%)
EFh 56..118 CDD:238008 24/109 (22%)
EF-hand_7 57..117 CDD:290234 23/107 (21%)
EFh 92..164 CDD:238008 11/33 (33%)
EF-hand_7 93..163 CDD:290234 10/32 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.