Sequence 1: | NP_001284770.1 | Gene: | CG32812 / 31074 | FlyBaseID: | FBgn0025642 | Length: | 225 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_000936.1 | Gene: | PPP3R1 / 5534 | HGNCID: | 9317 | Length: | 170 | Species: | Homo sapiens |
Alignment Length: | 203 | Identity: | 43/203 - (21%) |
---|---|---|---|
Similarity: | 94/203 - (46%) | Gaps: | 38/203 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 VGSRQLNPVQLCDHQQATGLSAEQLEQLHTRFRSLDRHQRGYLTPTDLLRIPQLSLNPLHRQIID 68
Fly 69 GFFPSRDPSARIGFKQFVDTCSTILVPQFGRGSVRRRDGRVQKLQLLSKMFDTRRSGCITRSDFR 133
Fly 134 QIMRSIVNLAWSQQQDQERQEGLSENRLPEVEAELQLLEHQAFGFCCD---HISYGEFEKRLFSV 195
Fly 196 DVDRRLSI 203 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32812 | NP_001284770.1 | EF-hand_7 | 31..136 | CDD:290234 | 28/104 (27%) |
EF-hand_6 | 117..139 | CDD:290141 | 4/21 (19%) | ||
PPP3R1 | NP_000936.1 | FRQ1 | 13..157 | CDD:227455 | 39/178 (22%) |
Calcineurin A binding. /evidence=ECO:0000269|PubMed:12218175, ECO:0000269|PubMed:12357034, ECO:0000269|PubMed:17498738, ECO:0000269|PubMed:22343722, ECO:0000269|PubMed:23468591, ECO:0000269|PubMed:26794871, ECO:0000269|PubMed:27974827, ECO:0000269|PubMed:8524402 | 131..136 | 1/4 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0034 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1271942at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |