DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and TESC

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:XP_016875021.1 Gene:TESC / 54997 HGNCID:26065 Length:251 Species:Homo sapiens


Alignment Length:173 Identity:44/173 - (25%)
Similarity:82/173 - (47%) Gaps:18/173 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GSVGSRQLNPVQLCDHQQATGLSAEQLEQLHTRFRSLDRHQRGYLTPT----DLLRIPQLSLNPL 62
            |::|:......::.:.:..||.|::|:||||.||:.|...|     ||    :...:|.|.|||:
Human    52 GTMGAAHSASEEVRELEGKTGFSSDQIEQLHRRFKQLSGDQ-----PTIRKENFNNVPDLELNPI 111

  Fly    63 HRQIIDGFFPSRD----PSA---RIGFKQFVDTCSTILVPQFGRGSVRRRDGRVQKLQLLSKMFD 120
            ..:|:..||.:|:    ||.   .|.|:.|:...|............:....|.:||:.|..|:|
Human   112 RSKIVRAFFDNRNLRKGPSGLADEINFEDFLTIMSYFRPIDTTMDEEQVELSRKEKLRFLFHMYD 176

  Fly   121 TRRSGCITRSDFRQIMRSIVNLAWSQQQDQERQEGLSENRLPE 163
            :...|.||..::|.::..:  |:.:...::|....:::..:.|
Human   177 SDSDGRITLEEYRNVVEEL--LSGNPHIEKESARSIADGAMME 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 33/115 (29%)
EF-hand_6 117..139 CDD:290141 6/21 (29%)
TESCXP_016875021.1 FRQ1 73..>195 CDD:227455 37/126 (29%)
EFh 167..>195 CDD:298682 9/27 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156536
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.