DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and guca1d

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001011661.1 Gene:guca1d / 494573 ZFINID:ZDB-GENE-040724-231 Length:185 Species:Danio rerio


Alignment Length:183 Identity:37/183 - (20%)
Similarity:70/183 - (38%) Gaps:44/183 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DHQQATGLSAEQLEQLHTRFRSLDRHQRGYLTPTDLLRIPQL-SLNPLHRQIIDGFFPS--RDPS 77
            :|.....:.||.:...:.:|  :.....|.:|..:|..|..| .:|......:|..|.:  .|..
Zfish     4 NHASLDDILAEDMHHWYNKF--MRESPSGLITLFELKSILGLQGMNEDANSYVDQVFCTFDMDRD 66

  Fly    78 ARIGFKQFVDTCSTILVPQFGRGSVRRRDGRVQKLQLLSKMFDTRRSGCITRSDFRQIMRSIVNL 142
            ..|.|.:::...|.:|     :|.:.      |||:...|:||...:|.|.:.:...|..:|.::
Zfish    67 GYIDFVEYIAAISLML-----KGEIN------QKLKWYFKLFDQDGNGKIDKDELETIFTAIQDI 120

  Fly   143 AWSQQQD------------------------QERQEGLSENRLPEVEAELQLL 171
              ::.:|                        :|..||..|:  ||:...|::|
Zfish   121 --TRNRDIVPEEIVALIFEKIDVNGEGELTLEEFIEGAKEH--PEIMDMLKIL 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 23/107 (21%)
EF-hand_6 117..139 CDD:290141 6/21 (29%)
guca1dNP_001011661.1 EF-hand_8 28..76 CDD:290545 11/47 (23%)
EFh 53..110 CDD:238008 16/67 (24%)
EF-hand_7 56..114 CDD:290234 15/68 (22%)
EFh 89..157 CDD:238008 13/69 (19%)
EF-hand_7 90..154 CDD:290234 10/65 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.