DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and CanB

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001245531.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster


Alignment Length:201 Identity:43/201 - (21%)
Similarity:90/201 - (44%) Gaps:34/201 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VGSRQLNPVQLCDHQQATGLSAEQLEQLHTRFRSLDRHQRGYLTPTDLLRIPQLSLNPLHRQIID 68
            :|:....|:.:|     :...|:::.:|..|||.||....|.|:..:.:.:|:|..|||.:::||
  Fly     1 MGNETSLPMDMC-----SNFDADEIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVID 60

  Fly    69 GFFPSRDPSARIGFKQFVDTCSTILVPQFGRGSVRRRDGRVQKLQLLSKMFDTRRSGCITRSDFR 133
            .|  ..|.:..:.||:|:...|...|          |..::.||:...:::|....|.|:..:..
  Fly    61 IF--DADGNGEVDFKEFIQGVSQFSV----------RGDKLSKLRFAFRIYDMDNDGYISNGELF 113

  Fly   134 QIMRSIVNLAWSQQQDQERQEGLSENRLPE-VEAELQLLEHQAFGFCCDHISYGEFEKRLFSVDV 197
            |:::.:|.            ..|.:.:|.: |:..:...:....|    .||:.||...:.:.|:
  Fly   114 QVLKMMVG------------NNLKDTQLQQIVDKTICFADKDEDG----KISFDEFCSVVGNTDI 162

  Fly   198 DRRLSI 203
            .:::.:
  Fly   163 HKKMVV 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 29/104 (28%)
EF-hand_6 117..139 CDD:290141 4/21 (19%)
CanBNP_001245531.1 FRQ1 13..154 CDD:227455 38/168 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464107
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.