DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and CG14362

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_650320.1 Gene:CG14362 / 41695 FlyBaseID:FBgn0038186 Length:206 Species:Drosophila melanogaster


Alignment Length:142 Identity:38/142 - (26%)
Similarity:55/142 - (38%) Gaps:30/142 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TGLSAEQLEQLHTRFRSLD-------RHQRGYLTPTDLLRIPQLSLNPLHRQIIDGFFPSRDPSA 78
            |.||..|::.|:.||....       .|...|...:.||:     ||||...|::..|.::   .
  Fly    27 TALSRSQIKYLYIRFHQFSGGGKDPPSHLHKYNFYSGLLQ-----LNPLLPTILNSMFGNK---V 83

  Fly    79 RIGFKQFVDTCSTILVPQFGRGSVRRRDGRVQKLQLLSKMFDTRRSGCITRSDF----------- 132
            .|.|..|....||.........:..:.....:||:|:..|:|..:.|.||:.|.           
  Fly    84 TITFVDFALFLSTFQAHSLKTSNELKNVMMDKKLRLIFNMYDNNKDGRITKYDLVVVVHKLFSNL 148

  Fly   133 ---RQIMRSIVN 141
               .|||| |||
  Fly   149 LDHVQIMR-IVN 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 28/125 (22%)
EF-hand_6 117..139 CDD:290141 10/35 (29%)
CG14362NP_650320.1 EFh 116..183 CDD:238008 16/45 (36%)
EF-hand_7 117..182 CDD:290234 15/44 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469398
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46002
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.