DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and sowi

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_649671.2 Gene:sowi / 40809 FlyBaseID:FBgn0037460 Length:217 Species:Drosophila melanogaster


Alignment Length:99 Identity:17/99 - (17%)
Similarity:38/99 - (38%) Gaps:18/99 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 FPSRDPSARIGFK-QFVDTCSTILVPQ-----------FGRGSVRRRDGRVQKLQLLSKMFDTRR 123
            :.:.|...|:.|. :..||..|.::.:           :|.......:.:....:.|.|.||..:
  Fly   106 YTTNDIQVRMRFAFEVYDTKGTGVIDREQVGTACEKFFYGEDEDELNELKADMTEFLMKKFDLDK 170

  Fly   124 SGCITRSDFRQIMRS----IVNLAW--SQQQDQE 151
            .|.|:..|:..::..    :..|.|  ..::|::
  Fly   171 DGVISYEDYSTVVEQQPILVEFLGWLFPSKEDKD 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 14/76 (18%)
EF-hand_6 117..139 CDD:290141 6/25 (24%)
sowiNP_649671.2 EF-hand_7 115..179 CDD:290234 11/63 (17%)
EFh 116..178 CDD:238008 11/61 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.