DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and ppp3r1

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_989400.1 Gene:ppp3r1 / 395037 XenbaseID:XB-GENE-948794 Length:170 Species:Xenopus tropicalis


Alignment Length:203 Identity:43/203 - (21%)
Similarity:94/203 - (46%) Gaps:38/203 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VGSRQLNPVQLCDHQQATGLSAEQLEQLHTRFRSLDRHQRGYLTPTDLLRIPQLSLNPLHRQIID 68
            :|:....|:::|.|     ..|:::::|..||:.||....|.|:..:.:.:|:|..|||.:::||
 Frog     1 MGNEASYPLEMCSH-----FDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID 60

  Fly    69 GFFPSRDPSARIGFKQFVDTCSTILVPQFGRGSVRRRDGRVQKLQLLSKMFDTRRSGCITRSDFR 133
            .|  ..|.:..:.||:|::..|...|          :..:.|||:...:::|..:.|.|:..:..
 Frog    61 IF--DTDGNGEVDFKEFIEGVSQFSV----------KGDKEQKLRFAFRIYDMDKDGYISNGELF 113

  Fly   134 QIMRSIVNLAWSQQQDQERQEGLSENRLPEVEAELQLLEHQAFGFCCD---HISYGEFEKRLFSV 195
            |:::.:|.                 |.|.:.:.: |:::........|   .||:.||...:..:
 Frog   114 QVLKMMVG-----------------NNLKDTQLQ-QIVDKTIINADKDGDGRISFEEFCAVVGGL 160

  Fly   196 DVDRRLSI 203
            |:.:::.:
 Frog   161 DIHKKMVV 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 28/104 (27%)
EF-hand_6 117..139 CDD:290141 4/21 (19%)
ppp3r1NP_989400.1 FRQ1 13..157 CDD:227455 39/178 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.