DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and kcnip3a

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:XP_005169145.1 Gene:kcnip3a / 393792 ZFINID:ZDB-GENE-040426-1791 Length:259 Species:Danio rerio


Alignment Length:178 Identity:46/178 - (25%)
Similarity:71/178 - (39%) Gaps:43/178 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QATGLSAEQLEQLHTRF--RSLDRHQRGYLT--PTDLLRIPQLSLNPLHRQIIDGFFPSRDP--- 76
            |..||  ||| |..|:|  :.|....||:..  |:.|  :.:.:...::.|    |||..|.   
Zfish    78 QPEGL--EQL-QAQTKFTKKELQSLYRGFKNECPSGL--VDEETFKTIYSQ----FFPQGDATTY 133

  Fly    77 ------------SARIGFKQFVDTCSTILVPQFGRGSVRRRDGRVQKLQLLSKMFDTRRSGCITR 129
                        :..|.|:.||...|.:|     ||:|      .:||.....::|..:.|.||:
Zfish   134 AHFLFNAFDLDRNGSIRFEDFVIGLSVLL-----RGTV------TEKLNWAFNLYDINKDGYITK 187

  Fly   130 SDFRQIMRSIVNLAWSQQQDQERQEGLSENRLPEVEAELQLLEHQAFG 177
            .:...||:||.::.........|.|..||:    ||...|.::....|
Zfish   188 EEMLLIMKSIYDMMGRYTYPSVRDEAPSEH----VEKFFQKMDRNRDG 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 27/123 (22%)
EF-hand_6 117..139 CDD:290141 6/21 (29%)
kcnip3aXP_005169145.1 FRQ1 82..248 CDD:227455 44/174 (25%)
EF-hand_8 108..155 CDD:290545 9/52 (17%)
EFh 133..195 CDD:238008 16/72 (22%)
EFh 169..240 CDD:238008 18/67 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.