DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and CG3565

DIOPT Version :10

Sequence 1:NP_569899.3 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_611942.1 Gene:CG3565 / 37933 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster


Alignment Length:126 Identity:26/126 - (20%)
Similarity:41/126 - (32%) Gaps:48/126 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SRQLNPVQLC----------DHQQATGLSAEQLEQLHTRFRSLDRHQR----------------- 43
            |:|||..|:.          |..::..|..:..|.|..:| .||:...                 
  Fly   137 SKQLNGEQVGFFVGKFFESEDEDESIELRLDMKEMLFLKF-DLDKDTNIGVDEYYEVVRRQPMLL 200

  Fly    44 ---GYLTPTDLLRIPQLSLNPLHRQIIDGFFPSRDPSARIGFKQFVDTCSTILVPQFGRGS 101
               |.:.|.:    ||:.:..|...::..|..|  |:.||..|           |..|:.|
  Fly   201 ECFGRVFPPN----PQMEVLALCANVMSWFDDS--PNPRIMIK-----------PDGGKAS 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_569899.3 FRQ1 25..>139 CDD:444056 19/97 (20%)
CG3565NP_611942.1 None

Return to query results.
Submit another query.