DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and Cib2

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster


Alignment Length:177 Identity:39/177 - (22%)
Similarity:75/177 - (42%) Gaps:31/177 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QLCDHQQATGLSAEQLEQLHTRFRSLDRHQRGYLTPTDLL---------------RIPQLSLNPL 62
            :|.|:|..|..:.:::.::|.|||.|    |..|.|..:.               ::|:|..||.
  Fly    12 ELDDYQDCTFFTRKEILRVHKRFREL----RPDLVPRQMTEGQASSVKVPCECIEKMPELRENPF 72

  Fly    63 HRQIIDGFFPSRDPSARIGFKQFVDTCSTILVPQFGRGSVRRRDGRVQKLQLLSKMFDTRRSGCI 127
            .|:|.:.|  |||....:.|:.|:|..|..          ..:..|..|:....|::|..:.|.|
  Fly    73 RRRICEAF--SRDGQGNLSFEDFLDALSVF----------SEQAPRDIKVFYAFKIYDFDQDGFI 125

  Fly   128 TRSDFRQIMRSIVNLAWSQQQDQERQEGLSENRLPEVEAELQLLEHQ 174
            ..:|....:.::.....|.::.|:..:.:.|....:.:.:|.:||.:
  Fly   126 GHADLMSCLTTMTKNELSPEEHQQIADKVIEEADVDGDGKLSILEFE 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 29/119 (24%)
EF-hand_6 117..139 CDD:290141 5/21 (24%)
Cib2NP_611523.3 FRQ1 20..180 CDD:227455 36/169 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464101
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.