DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and guca1c

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_919374.1 Gene:guca1c / 373099 ZFINID:ZDB-GENE-030829-1 Length:188 Species:Danio rerio


Alignment Length:164 Identity:38/164 - (23%)
Similarity:64/164 - (39%) Gaps:28/164 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ATGLSAEQLEQLHTRFRSLDRHQRGYLTPTDLLRIPQLSLNPLHRQ---------IIDGFFP-SR 74
            |:.|.....|.:|..:....|.     :|:.|:.:.:|. |.|..|         :...||. ..
Zfish     5 ASNLDEVLAEDMHYWYNKFMRE-----SPSGLITLFELK-NMLEMQGMTEEASSYVDQVFFTFDM 63

  Fly    75 DPSARIGFKQFVDTCSTILVPQFGRGSVRRRDGRVQKLQLLSKMFDTRRSGCITRSDFRQIMRSI 139
            |....|.|.:::...|.:|     :|.:.      |||:...|:||...:|.|.|.:...|.::|
Zfish    64 DGDGYIDFVEYIAAVSLLL-----KGEIN------QKLKWYFKLFDQDGNGKIDRDEMETIFKAI 117

  Fly   140 VNLAWSQQQDQERQEGLSENRLP-EVEAELQLLE 172
            .::..|.:...:....|...|:. ..|.||.|.|
Zfish   118 QDITRSYEIPPDDIVSLIYERIDVNNEGELTLEE 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 25/114 (22%)
EF-hand_6 117..139 CDD:290141 7/21 (33%)
guca1cNP_919374.1 FRQ1 6..162 CDD:227455 37/163 (23%)
EFh 53..110 CDD:238008 17/67 (25%)
EFh 89..157 CDD:238008 18/63 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.