DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and chp2

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_956130.1 Gene:chp2 / 327599 ZFINID:ZDB-GENE-030131-5810 Length:195 Species:Danio rerio


Alignment Length:209 Identity:60/209 - (28%)
Similarity:102/209 - (48%) Gaps:24/209 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSVGSRQLNPVQLCDH-QQATGLSAEQLEQLHTRFRSLDRHQRGYLTPTDLLRIPQLSLNPLHR 64
            |||..|..|..:...|. .|.||.|...:.:|:.||.:||:.:||:|.|.|...|.:|::||:..
Zfish     1 MGSSSSTLLKKIPNVDELMQETGFSPAHIIRLYERFEALDKERRGHLCPQDFGAIKELAMNPIGD 65

  Fly    65 QIIDGFF-PSRDPSARIGFKQFVDTCSTILVPQFGR----GSVRRRDGRVQKLQLLSKMFDTRRS 124
            :|||.|| |.:|   .:.|..||...:........|    .|....:.|..||:...:::|..:.
Zfish    66 RIIDAFFSPGKD---TVDFHTFVKILAHFRPVDKDRPKEPNSPEPINSRSNKLKFAFQLYDQDKD 127

  Fly   125 GCITRSDFRQIMRSIVNLAWSQQQDQERQEGLSENRLPEVEAELQLLEHQAFGFCCDHISYGEFE 189
            |.|:|.:..:::|.::.|    |..:|:.|.:::..:.|.:.:..           |.||:.||.
Zfish   128 GKISRDELLKVLRDMLGL----QVTEEQLESIADRTIQEADLDRD-----------DAISFEEFR 177

  Fly   190 KRLFSVDVDRRLSI 203
            |.|..|::|.::||
Zfish   178 KSLEKVNIDHKMSI 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 33/109 (30%)
EF-hand_6 117..139 CDD:290141 5/21 (24%)
chp2NP_956130.1 FRQ1 17..178 CDD:227455 48/178 (27%)
EFh 114..178 CDD:238008 17/78 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592179
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46002
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.