DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and chp1

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_956009.1 Gene:chp1 / 325361 ZFINID:ZDB-GENE-030131-4086 Length:194 Species:Danio rerio


Alignment Length:210 Identity:61/210 - (29%)
Similarity:107/210 - (50%) Gaps:27/210 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSVGSRQLNPVQLCDHQQATGLSAEQLEQLHTRFRSLDRHQRGYLTPTDLLRIPQLSLNPLHRQ 65
            |||..|..|....:.:.::.||.|..|:.:|::||.|||:.:.|.|:..|..|||:|::|||..:
Zfish     1 MGSRASSLLREEDIEEIKKETGFSHSQITRLYSRFHSLDKGENGGLSREDFQRIPELAINPLGDR 65

  Fly    66 IIDGFFPSRDPSARIGFKQFVDTCSTILVPQFGRGSVRRRD-------GRVQKLQLLSKMFDTRR 123
            ||:.|||..:.  ::.|:.|:.|.:.....:   .:.:.:|       .|..||....:::|..|
Zfish    66 IINAFFPEGED--QVNFRGFMRTLAHFRPVE---DNEKNKDLTGEPLNSRTNKLLFAFRLYDLDR 125

  Fly   124 SGCITRSDFRQIMRSIVNLAWSQQQDQERQEGLSENRLPEVEAELQLLEHQAFGFCCDHISYGEF 188
            ...|:|.:..|::|.:|.:            .:|:.:|..: |:..:.|....|..|  ||:.||
Zfish   126 DDKISRDELLQVLRMMVGV------------NISDEQLGSI-ADRTIQEADTNGDMC--ISFNEF 175

  Fly   189 EKRLFSVDVDRRLSI 203
            .|.|..|||::::||
Zfish   176 TKVLEKVDVEQKMSI 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 33/111 (30%)
EF-hand_6 117..139 CDD:290141 6/21 (29%)
chp1NP_956009.1 FRQ1 1..181 CDD:227455 56/199 (28%)
EFh 113..179 CDD:238008 20/80 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592176
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46002
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.