DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and Chp2

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:XP_038934165.1 Gene:Chp2 / 308965 RGDID:727796 Length:252 Species:Rattus norvegicus


Alignment Length:214 Identity:58/214 - (27%)
Similarity:109/214 - (50%) Gaps:34/214 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SVGSRQLNPVQLCDHQQ---ATGLSAEQLEQLHTRFRSLDRHQRGYLTPTDLLRIPQLSLNPLHR 64
            ::|||..:...:.|..|   .||.|...|.:|:.||::|||.::|:|:..||.:|..|::|||..
  Rat    56 AMGSRSSHVALIPDVDQIRRETGFSQASLLRLYHRFQALDREEKGFLSRLDLQQIGALAVNPLGD 120

  Fly    65 QIIDGFFPSRDPSARIGFKQFV----------DTCSTILVPQFGRGSVRRRDGRVQKLQLLSKMF 119
            :|||.|||  :.|.|:.|..|.          :..:|:..|:    .....:.|:.||:...:::
  Rat   121 RIIDSFFP--NGSQRVYFAGFARVLAYFRPIDEDDATLRDPK----QPEPLNSRMNKLRFAFQLY 179

  Fly   120 DTRRSGCITRSDFRQIMRSIVNLAWSQQQDQERQEGLSENRLPEVEAELQLLEHQAFGFCCDHIS 184
            |..|.|.|:|::..|::|.:|.:    |...|:.|.:::..:.|.:.:..           ..:|
  Rat   180 DLDRDGKISRNEMLQVLRLMVGV----QVTDEQLESITDRTVQEADEDGD-----------GAVS 229

  Fly   185 YGEFEKRLFSVDVDRRLSI 203
            :.||.|.|..:::::::||
  Rat   230 FLEFAKSLEKMNIEQKMSI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 36/114 (32%)
EF-hand_6 117..139 CDD:290141 7/21 (33%)
Chp2XP_038934165.1 FRQ1 79..235 CDD:227455 47/176 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350473
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46002
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.