DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and KCNIP2

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_055406.2 Gene:KCNIP2 / 30819 HGNCID:15522 Length:285 Species:Homo sapiens


Alignment Length:194 Identity:49/194 - (25%)
Similarity:77/194 - (39%) Gaps:44/194 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RQLNPVQLCDHQQATGL--SAEQLEQL--HTRF--RSLDRHQRGYLT--PTDLLRIPQLSLNPLH 63
            |.|:|..:.|..:.:.:  ..|.||||  .|:|  :.|....||:..  |:.::.....      
Human    85 RLLDPDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNECPSGIVNEENF------ 143

  Fly    64 RQIIDGFFPSRDPS---------------ARIGFKQFVDTCSTILVPQFGRGSVRRRDGRVQKLQ 113
            :||...|||..|.|               ..:.|:.||...|.||     ||:|..|      |.
Human   144 KQIYSQFFPQGDSSTYATFLFNAFDTNHDGSVSFEDFVAGLSVIL-----RGTVDDR------LN 197

  Fly   114 LLSKMFDTRRSGCITRSDFRQIMRSIVNLAWSQQQDQERQEGLSENRLPEVEAELQLLEHQAFG 177
            ....::|..:.||||:.:...||:||.::.........|:|...|:    ||:..|.::....|
Human   198 WAFNLYDLNKDGCITKEEMLDIMKSIYDMMGKYTYPALREEAPREH----VESFFQKMDRNKDG 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 30/125 (24%)
EF-hand_6 117..139 CDD:290141 7/21 (33%)
KCNIP2NP_055406.2 FRQ1 108..274 CDD:227455 44/171 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.